PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G086400.1.p
Common NameLOC101757032, SETIT_006922mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRF
Protein Properties Length: 327aa    MW: 34981.1 Da    PI: 9.5394
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G086400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.26.8e-2486129144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCsr++ + +k+CE+H+hrg+srsrk++e
  Seita.4G086400.1.p  86 DPEPGRCRRTDGKKWRCSREAHGESKYCEKHIHRGKSRSRKPVE 129
                         79***************************************998 PP

2QLQ613.4e-211347236
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                         FTa+Q+q+L++Q+l+yKy+a+++PvP++L+++++
  Seita.4G086400.1.p 13 LFTASQWQELEHQALIYKYMASGAPVPHDLVLPLR 47
                        5*******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.8E-91248IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.1431348IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-151446IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.09786130IPR014977WRC domain
PfamPF088795.0E-1987129IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MMLSGHGGGG RRLFTASQWQ ELEHQALIYK YMASGAPVPH DLVLPLRLAT GVDTAPSLAF  60
PPQTSPTLGY WGCYGAGAPF GRKAEDPEPG RCRRTDGKKW RCSREAHGES KYCEKHIHRG  120
KSRSRKPVEA VASSAATSPA AGAYRPSALS ISPPRAPDAA PTTFGHQQQH HLHYGASSGR  180
APAGPLQLHL DAASLHAASP PPSYHRYSHA HAHAHYATPP SLFPGSYSHG QSKELQDAEL  240
RRRHYLALGA DLSLDKPPAA AAATEEKPLR RFFDEWPREG GDARPWAMGA EDATQLSISI  300
PAASPSDLAA AAAARYHNGE SKRLGL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964938.10.0PREDICTED: growth-regulating factor 2-like isoform X1
SwissprotQ6AWY72e-95GRF2_ORYSJ; Growth-regulating factor 2
TrEMBLK3XYB40.0K3XYB4_SETIT; Uncharacterized protein
STRINGSi006922m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139922527
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-41growth-regulating factor 5